CDS

Accession Number TCMCG077C02326
gbkey CDS
Protein Id KAF5727582.1
Location complement(join(12040037..12040173,12040329..12040477,12040850..12040860))
Organism Tripterygium wilfordii
locus_tag HS088_TW22G01278

Protein

Length 98aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA542587, BioSample:SAMN11634134
db_source JAAARO010000022.1
Definition hypothetical protein HS088_TW22G01278 [Tripterygium wilfordii]
Locus_tag HS088_TW22G01278

EGGNOG-MAPPER Annotation

COG_category H
Description Catalytic subunit of the molybdopterin synthase complex, a complex that catalyzes the conversion of precursor Z into molybdopterin. Acts by mediating the incorporation of 2 sulfur atoms from thiocarboxylated MOCS2A into precursor Z to generate a dithiolene group
KEGG_TC -
KEGG_Module -
KEGG_Reaction R09395        [VIEW IN KEGG]
KEGG_rclass RC02507        [VIEW IN KEGG]
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko01000        [VIEW IN KEGG]
KEGG_ko ko:K03635        [VIEW IN KEGG]
EC 2.8.1.12        [VIEW IN KEGG]        [VIEW IN INGREDIENT]
KEGG_Pathway ko00790        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko04122        [VIEW IN KEGG]
map00790        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map04122        [VIEW IN KEGG]
GOs GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005829        [VIEW IN EMBL-EBI]
GO:0006139        [VIEW IN EMBL-EBI]
GO:0006163        [VIEW IN EMBL-EBI]
GO:0006725        [VIEW IN EMBL-EBI]
GO:0006732        [VIEW IN EMBL-EBI]
GO:0006753        [VIEW IN EMBL-EBI]
GO:0006793        [VIEW IN EMBL-EBI]
GO:0006796        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009058        [VIEW IN EMBL-EBI]
GO:0009116        [VIEW IN EMBL-EBI]
GO:0009117        [VIEW IN EMBL-EBI]
GO:0009119        [VIEW IN EMBL-EBI]
GO:0009141        [VIEW IN EMBL-EBI]
GO:0009144        [VIEW IN EMBL-EBI]
GO:0009150        [VIEW IN EMBL-EBI]
GO:0009199        [VIEW IN EMBL-EBI]
GO:0009205        [VIEW IN EMBL-EBI]
GO:0009259        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0016782        [VIEW IN EMBL-EBI]
GO:0016783        [VIEW IN EMBL-EBI]
GO:0018130        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0019637        [VIEW IN EMBL-EBI]
GO:0019693        [VIEW IN EMBL-EBI]
GO:0030366        [VIEW IN EMBL-EBI]
GO:0032324        [VIEW IN EMBL-EBI]
GO:0034641        [VIEW IN EMBL-EBI]
GO:0042278        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043545        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044249        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044281        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0046039        [VIEW IN EMBL-EBI]
GO:0046128        [VIEW IN EMBL-EBI]
GO:0046483        [VIEW IN EMBL-EBI]
GO:0051186        [VIEW IN EMBL-EBI]
GO:0051188        [VIEW IN EMBL-EBI]
GO:0051189        [VIEW IN EMBL-EBI]
GO:0055086        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0072521        [VIEW IN EMBL-EBI]
GO:0090407        [VIEW IN EMBL-EBI]
GO:1901068        [VIEW IN EMBL-EBI]
GO:1901135        [VIEW IN EMBL-EBI]
GO:1901360        [VIEW IN EMBL-EBI]
GO:1901362        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]
GO:1901566        [VIEW IN EMBL-EBI]
GO:1901576        [VIEW IN EMBL-EBI]
GO:1901657        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGAAGTTCGGATCACAAAGAAGATCTCTGAGGCAGTGAAAACACTTGTTCAAATCTTAGAAGACAATATCCCGATTGACATTGCCAAGTACATAAACTATGTCTCGCAAGCTGGTGCCATTGCGACATTTTCAGGCATCACGCGAGACACTTTTGAAGTCTCAGCAGTTCATCGCGCTGATGCTCTGGACGCTTGTAAGTTTTTGATCGACAAGTTAAAAGCATCTGTTCCAATATGGAAGAACGAGGTCTACGACACCGGAGAAGGATGGGATCTGTTGCAGAAGAAAGATTGA
Protein:  
MEVRITKKISEAVKTLVQILEDNIPIDIAKYINYVSQAGAIATFSGITRDTFEVSAVHRADALDACKFLIDKLKASVPIWKNEVYDTGEGWDLLQKKD